PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g061290.1
Common NameMTR_140s0014, MTR_3g061290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 204aa    MW: 23820.2 Da    PI: 9.9222
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g061290.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.15.1e-16191001196
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++rl +p kf+++hg     s  + ++ ++g +W+v+   +k +g+++++kGWk F +   L  g  vvF+++g+s+f  v+  
  Medtr3g061290.1  19 SNLQRLKIPHKFTKKHGVG--LSNPVLIKPPDGTKWKVYW--KKIDGEIWFEKGWKYFTENYSLGHGSLVVFEYKGTSKFDVVILG 100
                      3457899*********644..55569999***********..**********************************9999666654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.6899102IPR003340B3 DNA binding domain
SuperFamilySSF1019361.33E-2110102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.5E-2111102IPR015300DNA-binding pseudobarrel domain
CDDcd100172.41E-141199No hitNo description
SMARTSM010192.8E-1512102IPR003340B3 DNA binding domain
PfamPF023621.8E-1319100IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MARRNATFPI HFFKIILQSN LQRLKIPHKF TKKHGVGLSN PVLIKPPDGT KWKVYWKKID  60
GEIWFEKGWK YFTENYSLGH GSLVVFEYKG TSKFDVVILG RNAVEIDYDT SCDTDDENDN  120
VGHSDDESVE ILDEWPNQKS TGKRSPLFSP RPYKKVRGEI GKRERTCREI GEKFKTSPVW  180
LQRERGKRDQ NMWDPWLFLV SPK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0095110.0CT009511.9 M.truncatula DNA sequence from clone MTH2-69I7 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600447.11e-150plant-specific B3-DNA-binding domain protein
TrEMBLG8A3001e-150G8A300_MEDTR; B3 domain-containing protein
STRINGGLYMA20G24268.19e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-21B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]